PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00499.1.g00150.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 673aa    MW: 73313.8 Da    PI: 7.819
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00499.1.g00150.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-201671156
                                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  r++ +++t+ q+++Le++F+++++p++++r+ L+++lgL+ rq+k+WFqNrR+++k
  Zpz_sc00499.1.g00150.1.sm.mk 16 RKRYHRHTPRQIQQLEAMFKECPHPDENQRAALSRELGLEPRQIKFWFQNRRTQMK 71
                                  688899***********************************************998 PP

2START112.37.2e-3620936271205
                                   CT-TT-S....EEEEEEEECTT.............EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-T CS
                         START  71 qWdetla....kaetlevissg.............galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdse 133
                                   +W e ++    ka t++v+ +g              + ++m+ el  ++p+vp R+f f+Ry++q ++g w+ivdvS+d +
  Zpz_sc00499.1.g00150.1.sm.mk 209 KWMEFFPgivsKAHTVDVLVNGmcgrnesvimglmVVSTQMYEELHIMTPVVPtREFCFLRYCKQIEQGLWAIVDVSTDGQ 289
                                   67777777777999**************9999997777899***************************************9 PP

                                   TS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                         START 134 qkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                                   ++     +  R+++lpSg+li +++ng+skvtwveh++ +  lp   l+r lv sg+a+ga +wva+lqr c 
  Zpz_sc00499.1.g00150.1.sm.mk 290 REAHYGVPPSRSRRLPSGCLIADMANGYSKVTWVEHMEIEQMLPiNVLYRNLVLSGAAFGAHRWVAALQRACD 362
                                   9998888889**********************************999***********************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.76E-20976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-221078IPR009057Homeodomain-like
PROSITE profilePS5007117.8641373IPR001356Homeobox domain
SMARTSM003899.6E-201477IPR001356Homeobox domain
CDDcd000861.99E-191574No hitNo description
PfamPF000463.6E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
SMARTSM002341.3E-13134363IPR002913START domain
PfamPF018522.1E-30207362IPR002913START domain
CDDcd088755.26E-68208361No hitNo description
PROSITE profilePS5084831.17209366IPR002913START domain
SuperFamilySSF559618.1E-20210364No hitNo description
Gene3DG3DSA:3.30.530.202.1E-5257344IPR023393START-like domain
SuperFamilySSF559614.67E-7383488No hitNo description
SuperFamilySSF559614.67E-7542660No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MDFGDEPEGS DSQRRRKRYH RHTPRQIQQL EAMFKECPHP DENQRAALSR ELGLEPRQIK  60
FWFQNRRTQM KAQHERADNC FLRAENDKIR CENITMSEAL KNVICPNCGG PPVAEDFFDE  120
QKLRMENARL KEELDRVSSI TSKYLGRPFT QMPPMPTMSA SSLDLSVGGM PGPAFGGPGL  180
DLDLLGGGSA GPGMCPSGLP CCFCLVQHKW MEFFPGIVSK AHTVDVLVNG MCGRNESVIM  240
GLMVVSTQMY EELHIMTPVV PTREFCFLRY CKQIEQGLWA IVDVSTDGQR EAHYGVPPSR  300
SRRLPSGCLI ADMANGYSKV TWVEHMEIEQ MLPINVLYRN LVLSGAAFGA HRWVAALQRA  360
CDRVASLAAL GVPHHDPSGV TAEGKRGMMK LSQRMVSCFC ASLTSSPLQL WTTLSGTTDV  420
SVRVSTYRSA DLGQHSGVVL GAAASIWLPV PSEHVFAFVR NERTRSQVHV HTYRVRSRRL  480
RHFINNARGG VDVVTTSSCR ATPLTDVSLT SPLLPQWDVL AHGNQVQEVS RITSGSNAGN  540
CISLLRGLNS SQNSRLILQE SCTDASGSMV VYSPIDLLAA NVVMSGEDPS GIPLLPSGFA  600
ILPDGRPGTG SGASSSAGPP LAPPPGCLVT VAFQIVVSSL PSSRLNEESV STINSLVTST  660
VQNIRAALNC TGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0668131e-180BT066813.2 Zea mays full-length cDNA clone ZM_BFb0073D09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438026.10.0hypothetical protein SORBIDRAFT_10g006820
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLC5Z6D60.0C5Z6D6_SORBI; Putative uncharacterized protein Sb10g006820
STRINGSb10g006820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-116homeodomain GLABROUS 11